SKU: 93863438646

TWEAKR/TNFRSF12A Fc Chimera Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 17 - Jul 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TWEAKR/TNFRSF12A Fc Chimera Protein, HumanProduct Specification Species Human Antigen TWEAKR TNFRSF12A Synonyms TNFRSF12A,FGF inducible 14,FN14,TweakR,CD266 Accession Q9NP84 Amino Acid Sequence Glu28 Trp79, with N terminal Human IgG Fc

Product Specification


Species Human
Antigen TWEAKR/TNFRSF12A
Synonyms TNFRSF12A,FGF-inducible 14,FN14,TweakR,CD266
Accession Q9NP84
Amino Acid Sequence

Glu28-Trp79, with N-terminal Human IgG Fc

PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGREQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW

Expression System HEK293
Molecular Weight 33-35kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Feng, S. et al. (2000) Am J. Pathol.156:1253.

Background

TNFRSF12A was initially identified as a fibroblast growth factor-1-inducible gene in murine NIH 3T3 cells, and was named as fibroblast growth factor-inducible-14 (Fn14) gene.     Human TNFRSF12A was cloned from a HUVEC cDNA library and identified as the TWEAK receptor and a member of the TNFR family. TNFRSF12A is highly expressed in heart, placenta and kidney. TNFRSF12A / FN14 promotes angiogenesis and the proliferation of endothelial cells. TNFRSF12A and its ligand play a key role in muscle atrophy, cerebral ischemia, kidney injury, atherosclerosis, experimental autoimmune encephalitis, rheumatoid arthritis, and inflammatory bowel disease.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93863438646

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kindle Customer
San Leandro, US
★★★★★ 5
Perfect for my studio
Color: Black
Naught this chair for my bedroom home recording studio. Honestly, I bought it mostly for the look. I just thought it would look great with what I was trying to v to do in the studio. I was very pleasantly surprised to find that’s its much more comfortable than I had assumed. It was easy to assemble. The provided assembly instructions were clear and easy to follow. It took me less than 20 minutes to build it. The build quality is solid. I’m a tall well build dude that weights more than 210 lbs and it takes my weight very well. Great little chair. I recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
O
Verified Purchase
oaday
Grantham, US
★★★★★ 5
Very happy customer!
Color: Cream White, Color: Cream White
This chair is what you are looking for!!! No serious friends, this chair is everything and so incredibly comfortable! I’m so happy with this purchase. The wood accents I believe are actual wood and the PU leather is gorgeous and seriously looks like real leather. The size is perfect for my frame too. I’m a size medium bottom girly and the curve and level of cushion on the seat is so well executed. The rollability of the rollers are fantastic too, not super loud on our wooden floors and a really smooth glide. Im on the search for a rug to go under my desk but man the patience I used to wait to find this chair truly was worth it. A total lesson on patience and biting when you find the right thing. I think it’s pretty sturdy too. But I’ll report back in a few months. At the moment nothing leads me to be suspicious of a less than long life for this chair.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026
E
Verified Purchase
E
Fort Morgan, US
★★★★★ 4
Good product, could improve backrest depth.
Color: Cream White
Comfortable seat. Stylish looking. Works well. Con is that the backrest is too far away, I had to add a lumbar support pillow. I also added a waffle seat for added comfort as I sit all day in the office. Easy to assemble. Color is nice. Feels sturdy. Rocks back, nice feature. Smooth wheels.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
U
Verified Purchase
Ursa
Waukegan, US
★★★★★ 5
Great production
Color: Cream White
It’s very comfy and doesn’t take too much space like those gaming chairs which I like a lot. I also like the back of the chair is not all the way up but it’s supporting the waist and the back very well. Easy to assemble and very pretty ivory faux leather and wood combination.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
N
Verified Purchase
Nancy Ames
Los Angeles, US
★★★★★ 5
Sturdy back chair
Color: Khaki
This chair is beautiful and very comfortable. My daughter wants it. My son put it together in half an hour. Thank you
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026

recommand products