JAM-C Fc Chimera Protein, Human
SKU: 73714798192

JAM-C Fc Chimera Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

JAM-C Fc Chimera Protein, HumanProduct Specification Species Human Antigen JAM C Synonyms CD323; JAM 2; JAM3; JAMC; JAM C; JAM CFLJ14529; junctional adhesion molecule 3JAM 3; junctional adhesion molecule C Accession Q9BX67 Amino Acid Sequence Val32 Asn241, with C terminal Human IgG Fc

Product Specification


Species Human
Antigen JAM-C
Synonyms CD323; JAM-2; JAM3; JAMC; JAM-C; JAM-CFLJ14529; junctional adhesion molecule 3JAM-3; junctional adhesion molecule C
Accession Q9BX67
Amino Acid Sequence

Val32-Asn241, with C-terminal Human IgG Fc VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 57-65kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Chavakis, T. et al. (2003) Thromb. Haemost. 89:13.2.Aurrand-Lions, M. et al. (2001) Blood 98:3699.3.Spermatid differentiation requires the assembly of a cell polarity complex downstream of junctional adhesion molecule-C.Gliki G., Ebnet K., Aurrand-Lions M., Imhof B.A., Adams R.H.4.Antibody against junctional adhesion molecule-C inhibits angiogenesis and tumor growth.Lamagna C., Hodivala-Dilke K.M., Imhof B.A., Aurrand-Lions M.

Background

The family of junctional adhesion molecules (JAM), comprised of at least three members, are type I transmembrane receptors belonging to the immunoglobulin (Ig) superfamily. These proteins are localized in the tight junctions between endothelial cells or epithelial cells. Some family members are also found on blood leukocytes and platelets.Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM2 to regulate different cellular processes.Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow.At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3.Plays a central role in leukocytes extravasation by facilitating transmigration through the endothelium.Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation.Also functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN).Plays a role in angiogenesis.Plays a role in the regulation of cell migration.During myogenesis, it is involved in myocyte fusion.Promotes chemotaxis of vascular endothelial cells and stimulates angiogenesis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 73714798192

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 849 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mother of M.M.
Dallas, US
★★★★★ 5
Fantastic satin pillow cases for the price
Size: Queen (20" X 30"), Color: 02 - Pure White, Number of Items: 2
Edit: I already put five stars in the first place, but I was unfair to these pillow cases in my initial review! I thought they were a little warmer than the natural silk, because I was sleeping on them with acrylic pyjamas on. I have come to realise the pillow cases are not warm. They are truly excellent in every way. I just get sweaty every time I wear acrylic pyjamas! I have already ordered two more sets of these (and have switched to micrfibre pyjamas)! Original review: First off, I want to address a popular misconception. Satin is a weave, not a fibre. So polyester satin is real satin, and it is very common. To all the people saying the makers lied about the fabric, they absolutely did not! I bought these and I bought some inexpensive silk ones at the same time. I have been loving the silk ones and only started using these lately. I'm happy with all of them. These are not silk, and I can feel the difference, but they are a nice, smooth polyester satin. The white colour is indeed a pure white. I machine washed mine and hung them to dry. They did not wrinkle, pick or pill, and they did not change in colour or size. They look fresh and pristine. I measured my pillows and got the right size. They are pretty and neat, they seem to be well sewn and well finished, with no hanging threads. They are very soft to sleep on and did not make my dry, curly hair frizz up. I slept on them without my protective bonnet, so I got the full experience! Honestly, with the smooth, tight weave of the fabric, they may be superior to the real silk in terms of babying my skin and hair. However, they are a little bit warmer. That is fine for now, since the weather is cool. I might just use these while it is cool out and switch to silk in summer, or I might continue to alternate, we will see. Overall, I am happy with my purchase and would buy them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
A
Verified Purchase
Amazon customer
Charlottesville, US
★★★★★ 5
Great quality & colors
Size: Body (20" X 54"), Color: 03 - Beige, Number of Items: 1
Good price so is easier to buy several colors. Perfect fit for a body pillow. Super there are pillow cases to match. Soft! Great quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
J
Verified Purchase
Jacqueline Coffey
Charlottesville, US
★★★★★ 5
Worth the price
Color: 35 - Lavender, Size: King
The best thing about these king-size sheets is the deep pockets—they stay securely in place and fit the mattress perfectly. They wash beautifully, resist wrinkles, and are incredibly soft and comfortable. A great combination of quality, comfort, and convenience.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
J
Verified Purchase
Judy L.
Boise, US
★★★★★ 5
Get the best sleep ever - soft, stay cool, don't wrinkle or pill after washing, and stay on.
Color: 25 - Burgundy, Size: Full
Prior to buying this set of sheets, I tried just the pillow cases. I had a more expensive set of Egyptian cotton sheets and pillow cases, but every night I had to flip the pillow because it was too warm even when the room was cool. I bought the pillow cases for both my husband and myself, and we both saw an immediate improvement in our Samsung watch sleep scores. The pillow cases were so soft and I no longer woke up during the night with my head being too warm. The sheets I had been using were supposed to be for thick mattresses, and fit at first. I have a 12 inch mattress, and after a few washings, these sheets wouldn't stay on one corner of the mattress. There was no way I could stretch it over all four corners. Since I was so happy with the pillow cases of this brand, I decided to buy the sheet set. As I normally do, I washed and dried the set before using them. The sheets are every bit as soft and comfortable as the pillow cases, and they were wrinkle free with absolutely no pilling after washing. Putting them on my 12 inch mattress was a breeze. They fit over all the corners and even tucked in on all sides. The sheets are every bit as soft and comfortable as the pillow cases I had bought previously. Since I put them on my bed when warm weather was coming, I put away some of the blankets and comforters I had on my bed for the winter. I found that these sheets, are not quite as warm as my previous heavier sheets. For me this is a good thing as I used to wake up in the night sweating with my PJ's stuck to me. When I pushed down the covers, I would be freezing because my PJ's were wet. Since my bedroom is usually cool, I put some of the blankets back on my bed, but now I don't wake up sweating. Now I can use my blankets without sweating and having to push them to the bottom of the bed during the night, and my sleep score, measured by my Samsung watch, is consistently 10 or more points higher than it was before using these sheets. If you tend to sleep warm, these sheets would be perfect for you. At this point, I very much prefer these sheets over the stiffer, heavier Egyptian cotton sheets that don't breath. I should also mention that I bought the burgundy color that is a true burgundy - not red. UPDATE 7/25/22: I have been using these sheets for almost 1 1/2 years, and they have been washed and dried multiple times. They still look and feel as good as the first time I used them. They have not pilled or shrunk, and still fit on my bed as well as they did when they were new. Although I bought the set for a double bed, the pillow cases are large enough to fit the queen sized pillows I have, and are long enough the enveloping flap on the ends of them is really not needed. I still love this set of sheets, and will likely buy another set. UPDATE 08/10/23: I have been using this set of sheets for about 2 1/2 years, I and I still love them. I have been using only this one set of sheets. I take them off my bed, machine wash and dry them, and put them back on. They have not shrunk, pilled, or faded, and look as good as the day I bought them. I like these so much better than cotton sheets I have had in the past, including Egyptian cotton. They are so soft, not stiff at all. I decided to buy another set in case they stop selling them and thought I would update my review while I was here. I hope this review was helpful for you. I will update my review if my opinion changes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2022
T
Verified Purchase
Tracey Hawkins
Whiting, US
★★★★★ 5
Extra deep queen sheet set 6 piece
Color: 18 - Navy Blue, Size: Queen
These sheets fit my 17" mattress perfectly. They dop pop off even after several days of getting in and out of bed. On occasion they do need to be pulled down. They are a great value for the money, I will be buying more in different colors. I love that they are wrinkle free and so soft. They're great if you have other colors to switch the flat or fitted sheet to create a new look.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026

recommand products