SKU: 15423015031

ASFV p54, His tag

Sale price$40.50 Regular price$45.00
Save 10%

Pay in installments of $11.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 16 - Jul 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ASFV p54, His tagProduct Specification Species African Swine Fever Synonyms pE183L Accession Q65194 Amino Acid Sequence Protein sequence(Q65194 Ser54 Leu183, with C 10*His) SRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSLGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 15. 5kDa Actual: 20kDa Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species African Swine Fever
Synonyms pE183L
Accession Q65194
Amino Acid Sequence

Protein sequence(Q65194 Ser54-Leu183, with C-10*His)
SRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSLGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical:15.5kDa Actual: 20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, 1mM DTT, pH7.4. Normally trehalose is added as protectant before lyophilization.
Reconstitution Reconstitute no more than 1mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

African swine fever (ASF) is a highly lethal hemorrhagic viral disease of swine that usually results to a mortality rate approaching 100% in domestic pigs and is classified as a notifiable disease by the World Organization for Animal Health (OIE). A number of studies have reported that p54 is one of the most important ASFV proteins and plays a key role in virus morphogenesis and viral infection. Anti-p54 sera were found to inhibit ASFV attachment to susceptible cells, suggesting its role in virus entry. Similarly, p54/E183L gene plays an essential role in virus viability and recruitment of envelop precursors to assembly sites. Most importantly, E183L gene is crucial for virus particle transporting to perinuclear factory via direct binding to light chain 8 (LC8) of the dynein. A short p54 peptide (149–161 aa) near to its C-terminus is enough to bind to dynein light chain 8 (DLC8) and act as a cargo transport for virus particle.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 15423015031

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
m. h.
Fort Morgan, US
★★★★★ 5
Well made dog toy
Color: Blue
The snoops are great for our active labrador. He is a very aggressive chewer, and so far, has not destroyed a snoop yet. He has mulitples. They are a great size for filling with treats or kibble and they keep him engaged in the activity. He even likes to carry them when he does his zoomies sometimes. They are lightweight and sturdy, and the material is nice and flexible. Great toy / puzzle ball to have around for your pup!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
A
Verified Purchase
Amazon Customer
Battle Creek, US
★★★★★ 5
Great for mental stimulation. Durable for my chewers!
Color: Purple Lil Snoop, Color: Purple Lil Snoop
Love these! Quality material, safe for dogs — I make my dogs home made freezer treats and fill these up with it, and serve. Keeps them busy for hours. It’s also fun for them to roll it around to get regular treats out of. Toy + treats = a very happy pup. This size I got for my puppy. The larger ones I use for my adult dogs. Super cute too, and silent! I have Mini Aussies, so it’s great mental stimulation for them. Tires them out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
R
Verified Purchase
Robyn Kanouse
Phoenix, US
★★★★★ 5
Very durable
Color: Blue
I have never written a review but just have to say how much our Pitbull LOVES this toy. It is very sturdy very good since he is such an aggressive chewer. This is only the second product I have found that he can’t destroy in 5 minutes. It keeps him busy for a long time and plays with it long after the treats are gone which is good as too many treats and he would gain weight. Highly recommend it. He weighes 70 lbs and the largest one is the perfect size. Kibble doesn’t work as it empties out immediately. I use Beggin Strips cut to size just to fit in the hole—they will come out but not all at once and survive his chewing on the toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026
C
Verified Purchase
Caleigh Meyer
Port Orchard, US
★★★★★ 4
Overall good toy for dogs
Color: Blue
My dog loves her snoop. I put little training treats in there for her, and she loves to roll it around and get the treats out. For her, it doesn’t last very long because they do fall out pretty easy, but she is a big dog so a smaller dog might have a harder time than her. Very sturdy and easy to travel with. Not noisy at all. I would say it’s a good, quick play toy for a dog like mine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
A
Verified Purchase
Anel
Boise, US
★★★★★ 5
Fav Chew Toy 🦴
Color: Blue, Color: Blue
My baby is half rottweiler and half doberman &’ he has a pretty strong grip when it comes to chew toys. But this one, it’s his favorite toy! He never leaves the house without it. It’s also really fun to add his favorite treats in there when’s he bored to keep him entertained! Not loud at all and will keep him from chewing on other things and not heavy as other rough chew toys!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products