SKU: 50602339356

Human Galectin-3, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 16 - Jul 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Galectin-3, His tagProduct Specification Species Human Synonyms Gal 3, 35 kDa lectin, Carbohydrate binding protein 35 (CBP 35), Galactose specific lectin 3, Galactoside binding protein (GALBP), IgE binding protein, L 31, Laminin binding protein, Lectin L 29, Mac 2 antigen, LGALS3, MAC2 Accession P17931 Amino Acid Sequence Protein sequence(P17931, Met1 Ile250, with C 10*His)

Product Specification


Species Human
Synonyms Gal-3, 35 kDa lectin, Carbohydrate-binding protein 35 (CBP 35), Galactose-specific lectin 3, Galactoside-binding protein (GALBP), IgE-binding protein, L-31, Laminin-binding protein, Lectin L-29, Mac-2 antigen, LGALS3, MAC2
Accession P17931
Amino Acid Sequence

Protein sequence(P17931, Met1-Ile250, with C-10*His)
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:27.8kDa Actual:35kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 is a member of the lectin family, of which 14 mammalian galectins have been identified. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Galectin-3 (Gal-3) is also a member of the beta-galactoside-binding protein family that plays an important role in cell-cell adhesion, cell-matrix interactions, macrophage activation, angiogenesis, metastasis, apoptosis. Galectin-3 is increasingly being used as a diagnostic marker for different cancers. It can be screened for and used as a prognostic factor to predict the progression of the cancer. Galectin-3 has varying effects in different types of cancer. One approach to cancers with high galectin-3 expression is to inhibit galectin-3 to enhance treatment response.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50602339356

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
V
Verified Purchase
Vaifro Dordetto Jr
Cuba, US
★★★★★ 5
Great value for a one-time event! Perfect for graduation.
Color: Black, Size: Large, Color: Black, Size: Large
I bought this suit for my son's graduation, and it was exactly what we needed. Since he will probably only wear it once, I didn't want to spend a fortune at a high-end department store. For the price, the quality is surprisingly good; it looked sharp and he received a lot of compliments during the ceremony. We ordered a size Large (L) based on their sizing chart, and it was true to size and fit him perfectly. The fabric is lightweight but doesn't look cheap at all, making this a fantastic, excellent cost-benefit choice if you are looking for an option for a one-time event. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
P
Verified Purchase
Patrick
Cuba, US
★★★★★ 5
Great for the price.
Color: Black, Size: Large, Color: Black, Size: Large
I’m 220lbs 6’1 athletic build. Arms/back couldn’t fit inside the jacket. Pants and vest fit fine though. I honestly should get stuff tailored considering my body competition. Good quality for the price worked for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
R
Verified Purchase
Regal Mom
Boise, US
★★★★★ 4
XL sized suit review
Color: Light Blue, Size: X-Large
I ordered XL for my husband who is 6'1" and weighs 200 lbs. The pants' length was too long and we had to cut off two inches and get them hemmed. Jacket could be a little bigger in the mid section and shoulders but vest fit well. Could do without the fake handkerchief in the suit jacket pocket. Still liked the style and the color of the light blue suit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
J
Verified Purchase
jessica vasquez
Chelsea, US
★★★★★ 5
Perfect for teens
Color: Black, Size: XX-Large
Great suit! Great quality for the price. Very impressed. Bought for my teens. Didn't want to spend a lot on something they won't wear more than a couple times before they grow again. This suit is great. A tad long in the arms and legs. But overall, its perfect. Fitting suit, but got a size larger for their comfort. Surprised at the quality, my mom was impressed and she knows suits.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
K
Verified Purchase
Katherine
Louisville, US
★★★★★ 5
Great suit!
Color: Black, Size: Medium
Looks super nice! For the price, it is definitely worth it. The fabric looks and feels great and the size range is good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026

recommand products