SKU: 976766220

RSPO3 Protein, Human

Sale price$154.80 Regular price$172.00
Save 10%

Pay in installments of $43.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 16 - Jul 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

RSPO3 Protein, HumanProduct Specification Species Human Synonyms R spondin 3 Accession Q9BXY4 1 Amino Acid Sequence Gln22 Val146, with C terminal 8*His QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVGGGSHHHHHHHH Expression System HEK293 Molecular Weight 16 and 20 24kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms R-spondin 3
Accession Q9BXY4-1
Amino Acid Sequence

Gln22-Val146, with C-terminal 8*His QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

16 and 20-24kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

R-spondin3 (RSPO3), an activator of Wnt/β-catenin signaling, plays a key role in tumorigenesis of various cancers. RSPO3 contains two adjacent cysteine-rich furin-like domains (aa 35-135) with one potential N-glycosylation site (aa 36), followed by a thrombospondin (TSP-1) motif (aa 147-207) and a region rich in basic residues (aa 211-269). RSPO3 is a novel contraction-inducible myokine produced by cultured human myotubes. Human RSPO3 is a paracrine factor that may positively participate in the myogenesis processes of myoblasts and satellite cells. RSPO3 promotes the tumor growth of choriocarcinoma via Akt/PI3K/ERK signaling, which supports RSPO3 as an oncogenic driver promoting the progression of choriocarcinoma. RSPO3 plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this protein with bone mineral density and risk of fracture. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 976766220

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dana J. Sheffield
Carnegie, US
★★★★★ 5
Great information!
Format: Paperback
Great information!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 20, 2019
S
Verified Purchase
Susan
Omaha, US
★★★★★ 5
Five Stars
Format: Paperback
love it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2018
S
Sherin
Birmingham, US
★★★★★ 3
Simple, Straightforward and Concise - Ideal for Beginners!
Format: Kindle
Written by Sophie Merle, The Book of Tapping: Emotional Acupressure with EFT is a short, concise and simple but straightforward guide to Tapping. What I liked best about this book is that - it is very easy to understand, making it possible for anyone and everyone to explore EFT. Since this is a very short book, I understand that not much is covered, just the basics predominantly, but if you are looking for an introduction to EFT Tapping and uncomplicated explanations and ideas, this is a book you can check out! **I was offered an eARC by Healing Arts Press through Net Galley in exchange for an honest review.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2017
J
Joseph J. Truncale
Louisville, US
★★★★★ 5
An excellent basic text for anyone interested in learning the EFT system.
Format: Paperback
Over the years I have read a several books on the healing art of tapping and I must say this 106 page soft cover volume (The book of Tapping: Emotional acupressure with EFT by Sophie Merle) is one of the best I have read lately. The step-by-step lessons are easy to follow and everything is explained in a clear and concise way. This book is organized into ten sections covering the following material: EFT: an energetic technique for health and material abundance, the EFT protocol, working with EFT, a collection of painful statements, the body’s meridians and their emotional function, the various ways EFT can be applied, EFT and the realization of goals, group sessions, two EFT variations and a conclusion. If you are seeking a good basic introduction to the EFT system you may want to check out this excellent book. Rating: 5 Stars. Joseph J. Truncale (Author: Chair/Seated Tai Chi, Qigong and Yoga stretching for seniors and the physically challenged).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2019
K
Kristine Fisher
New York, US
★★★★★ 2
The Book of Tapping by Sophie Merle is a free ...
Format: Paperback
The Book of Tapping by Sophie Merle is a free NetGalley ebook that I read in early February. The Book of Tapping discusses the use of EFT on the face, upper torso, and hands to loosen energy blockages along different meridians of the body and to relieve emotional stress in addition to physical ailments. There is mention of case studies, self-assessment techniques, a map of meridians, and glossary of EFT-related institutions and practitioners, but it's loosely held together by little else.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2017

recommand products