SKU: 75873897989

Mouse IgG kappa, His tag

Sale price$117.00 Regular price$130.00
Save 10%

Pay in installments of $32.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 16 - Jul 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IgG kappa, His tagProduct Specification Species Mouse Synonyms Ig kappa chain C region MOPC 21 Accession P01837 Amino Acid Sequence Protein sequence (P01837, Arg1 Cys107, with C 10*His) RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 6 kDa Observed MW: 13. 6 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Mouse
Synonyms Ig kappa chain C region MOPC 21
Accession P01837
Amino Acid Sequence

Protein sequence (P01837, Arg1-Cys107, with C-10*His) RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.6 kDa Observed MW: 13.6 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin kappa constant, also known as IGKC, is a gene that encodes the constant domain of kappa-type light chains for antibodies. The immunoglobulin light chain is the small polypeptide subunit of an antibody (immunoglobulin). A typical antibody is composed of two immunoglobulin (Ig) heavy chains and two Ig light chains. kappa (κ) chain is one of the two types of light chain in humans. A free light chains test measures the amount of lambda and kappa free light chains in the blood. If the amount of free light chains is higher or lower than normal, it can mean you have a disorder of the plasma cells. These include multiple myeloma, a cancer of plasma cells, and amyloidosis, a condition that causes a dangerous buildup of proteins in different organs and tissues.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 75873897989

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Thomas J. Shandorf
Louisville, US
★★★★★ 5
Comprehensive, clear and coherent!
Format: Paperback
The iTEP Practice Guide combines a no-nonsense approach to the specific iTEP tests and at the same time offers exercises that task the student with what they need to know. Exercises not only serve the purpose of scoring well, but the overall approach is communicative competence. We use the text in our group and one-to-one classes with very positive--and lasting--results.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 23, 2019
S
Verified Purchase
Sarah Sofía Ortiz Campos
Dallas, US
★★★★★ 1
No recomiendo
Format: Paperback
Muy malo, no vine completo, además se demoró mucho más de lo que decía al momento de comprarlo. Solo aplazaban la fecha de entrega sin consultar cómo afectaba al cliente. Yo tuve que presentar el examen sin el libro, porque no llegó en la fecha que decía al comprarlo y después se cambió 3 veces la fecha, casi cumpliendo el mes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 30, 2025
E
Verified Purchase
Elaine li
Charlottesville, US
★★★★★ 5
VERY EFFICIENT MATERIAL
Format: Paperback
It's the most efficient material to prepare the test.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2020
T
ThereseHazzard
Natrona Heights, US
★★★★★ 5
All around helpful---worth the money!
Format: Paperback
This guide has been most helpful for all the folks I help prepare for the iTEP test! It gives insight into what each section of the test is looking for along with examples and great tips about actually TAKING the test. In the Writing and Speaking sections, it also gives sample scores and comments from the Master Grader which is very helpful too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 9, 2019
T
Thomas J. Shandorf
Lowell, US
★★★★★ 5
Comprehensive, clear and coherent!
Format: Paperback
The iTEP Practice Guide combines a no-nonsense approach to the specific iTEP tests and at the same time offers exercises that task the student with what they need to know. Exercises not only serve the purpose of scoring well, but the overall approach is communicative competence. We use the text in our group and one-to-one classes with very positive--and lasting--results.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 23, 2019

recommand products