SKU: 7325219560

CD36/SR-B3 His Tag Protein, Cynomolgus

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 17 - Jul 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD36/SR-B3 His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms CD36, SR B3, SCARB3, BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV Accession Q4R6B4 Amino Acid Sequence Gly30 Asn439, with C terminal 10*His

Product Specification


Species Cynomolgus
Synonyms CD36, SR-B3, SCARB3, BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV
Accession Q4R6B4
Amino Acid Sequence

Gly30-Asn439, with C-terminal 10*His GDMLIQKTIKKEVVLEEGTIAFKNWVKTGTEIYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENITQDPKDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYPNPFVQVVLNSLINKSKSSMFQVRTLRELLWGYTDPFLSLVPYPVSTRVGMFYPYNNTADGVYKVFNGKDSISKVAIIDTYKGKRNLSYWESYCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVQNPDNHCFCTEKIISKNCTSYGVLDISKCKEGKPVYISLPHFLYASPDVSETIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSNKIQVLKRLKRNYIVPILWLNETGTIGDEKAKMFRSQVTGKINGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

72-82kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Okamoto F. et al. (1998) CD36 abnormality and impaired myocardial long-chain fatty acid uptake in patients with hypertrophic cardiomyopathy. Jpn Circ J. 62: 499-504.

2、Tanaka T. et al. (1997) Is CD36 deficiency an etiology of hereditary hypertrophic cardiomyopathy? J Mol Cell Cardiol. 29: 121-127.

3、Forte E. et al. (2018) The interstitium in cardiac repair: role of the immune-stromal cell interplay. Nat Rev Cardiol. 15: 601-616.

4、Coraci I S. et al. (2002) CD36, a class B scavenger receptor, is expressed on microglia in Alzheimer’s disease brains and can mediate production of reactive oxygen species in response to -amyloid fibrils. Am. J. Pathol. 160: 101-112.

Background

CD36 belongs to the scavenger receptor class B (SR-B), a family of highly glycosylated transmembrane receptors with a wide range of ligand recognition sites. It has been reported that glycosylation of CD36 is required for trafficking of intracellular CD36 to the cell surface membrane. Because of its wide range of ligands, CD36 has plenty of functions, including but not limited to recognizing and ingesting lipids, participating in the process of inflammatory response, signal transduction, and apoptosis. The expression occurs in monocytes/macrophages and microglia as well as various other cells and tissues, including microvascular endothelial cells, platelets, adipocytes, and the heart. CD36 promotes the podocyte injury in many kidney diseases including primary nephrotic syndrome, obesity-related glomerulopathy, and diabetic nephropathy. Moreover, genetic knockout or antagonist blockade of CD36 could alleviate kidney injury indicating that CD36 is a potential therapeutic target.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 7325219560

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gabby M
Omaha, US
★★★★★ 4
Powerful Family History
Format: Paperback
After the birth of her son, Thi Bui feels an increased sense of urgency about learning the stories of her own parents. Like all but her youngest sibling, she was born in Vietnam, though the children came of age in the United States. While the war itself haunts all of them, was the reason they left their homeland, the wounds her parents bear go far beyond the military conflict. This was only the second graphic novel I’ve ever read (both have been memoirs), and like the first was also selected by my book club. I feel like the limitations of the format mean it will always be a less preferred one for me, because I found myself wanting more words, more depth to the writing itself. But the story is deeply compelling, detailing her father’s brutal childhood, her mother’s much softer one, how they came together, and how the Vietnam War disrupted the future they thought they might have. It’s not as straightforward as “Americans bad”, and Bui is not afraid of the moral ambiguity of that time and place, where the best interests of the majority of the Vietnamese people was an open question for larger forces that seemed to have little room for consideration of what might have actually made regular lives easier to lead. And apart from the larger geopolitical machinations around them, the family had their own share of tragedy, including the death of their first child and a later stillbirth. But three living children and another on the way was enough for her parents to make frantic arrangements to leave, finally succeeding and eventually making their way to the United States. But of course, that was not the end of their story, just the beginning of a new chapter. Bui’s childhood as she depicts it makes it clear that it wasn’t the stuff dreams are made of, but what shines through is her tremendous empathy for her parents and how they became the people she experienced them as. Overarching the narrative is a meditation on parenthood, as it is the birth of her own child that inspires her to ask her parents more. They might have made major mistakes, but it is clear that they loved their children and did what they thought was best for them, making countless sacrifices to give them the best opportunities possible, even if that love was not always shown the way that they wanted and needed to feel it. Vietnamese perspectives on the war in their country were not something I was exposed to growing up (honestly the Vietnam War itself wasn’t something I remember being taught with particular rigor in high school apart from its connection to electoral politics), and I appreciated learning more about the history of the country and how the people who actually lived through the conflict thought about it. Even though this is not my preferred format, I think Bui uses it well to engage in some non-linear storytelling and to very literally illustrate what she’s trying to get it, like the way she parallels the way her relatively rural parents must have felt seeing Saigon for the first time with the way she felt when she first moved to New York, a sense of awe and possibility. It’s a powerful, moving work and I would recommend picking it up!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
R
Verified Purchase
Riyen
San Leandro, US
★★★★★ 5
Truly, the best we could do
Format: Kindle
An excerpt from my analysis essay I submitted for my literature course: By revisiting her family’s past from before, during, and after the Vietnam War, she gained a deeper understanding of the emotional burdens her parents carried and the sacrifices they made that defined the entirety of their lives. Bui’s illustrated graphic memoir reveals that trauma does not simply disappear over time; instead, it becomes inherited, processed, and transformed. Through this process, Thi Bui is able to move toward empathy for her parents, acceptance of who they are, and a more complete sense of self.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
K
Verified Purchase
Kathy
Phoenix, US
★★★★★ 5
Phenomenal. A must-read!
Format: Paperback
I first learned about this book only a week ago when visiting my sister for Thanksgiving in Eugene, Oregon. We went to the Jordan Schnitzer Museum of Art where I saw some work on display by the author, and there was a copy of her book available to look at, so I perused through and decided to buy it and read it. I'm so glad that I did! This is an incredible, poetic story that spans four generations, multiple wars and conflicts, and examines the fragility of the author's relationship with her parents and with her sense of place and motherhood. This book is one of the best I've read in a long time, and the art is moving and beautiful. It gave me new insight into the struggles of refugee life, and created a truly relatable narrative. I devoured this story in one Saturday. I highly recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2018
S
Verified Purchase
Sav
Bozeman, US
★★★★★ 5
A well composed memoir
Format: Paperback
Full review on nguyentoread.com The Best We Could Do is Thi Bui's graphic memoir. Thi was born in Vietnam three months before the Vietnam War reached what we consider to be the end of the war. She came to America with her family in 1978. Bui's memoir spans multiple generations. In learning of her mother's and father's pasts, we learn the history of their parents. We see the struggles and pains of two people from very different walks of life trying to live during a time of war and chaos. We see glimpses of the agony everyone in the middle of the Vietnam War faced. Those who were not directly involved on either side but were caught in the middle of larger powers at war. This memoir more closely details the lives of her parents leading up to them arriving in America and making their life there. I was unsure if this memoir would focus largely on the experience of being a Vietnamese immigrant in America. There were parts that showed how it was for Bui's parents in a country where tensions were still high after the Vietnam War, where discrimination largely due to that was overt, and where degrees were not recognized and people who had spent their lives working and creating careers for themselves were not qualified for most work and had to hurdle multiple challenges to learn a language and complete education all over again if they wanted to provide a better life for their children. What Bui so beautifully captures in this memoir is the why behind how her parents were in raising her. Although Bui was born in Vietnam she was young when her family arrived in America. So I think her experience is one that many first generation Vietnamese-American people of my generation can understand and sympathize with. The wanting to know why their parents are the way they are but unable to ask because many have parents, like Bui's mother, who reluctantly share their stories and don't allow their children that glimpse that could help them better understand. In the panel which was most poignant to me, Bui draws her father as he looks over her work that would become The Best We Could Do. He says "You know how it was for me. And why later I wouldn't be... normal."
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2019
N
Verified Purchase
Noah Beitzel
Lexington, US
★★★★★ 5
This book made me love my parents more
Format: Kindle
I loved the raw depictions of vietnamese history and human emotions. I recommend this book to anyone experiencing intergenerational trauma. 5 stars, this book helped me understand my father and mother just a little more, and that is priceless
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 25, 2025

recommand products