Pay in installments of $67.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 16 - Jul 21
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
LAG-3 GST Tag Protein, HumanProduct Specification Species Human Antigen LAG 3 Synonyms LAG 3,CD223 Antigen, Protein FDC, CD223, FDC, sLAG 3 Accession P18627 Amino Acid Sequence Leu23 Leu450, with N terminal GST Tag
Product Specification
| Species | Human |
| Antigen | LAG-3 |
| Synonyms | LAG-3,CD223 Antigen, Protein FDC, CD223, FDC, sLAG-3 |
| Accession | P18627 |
| Amino Acid Sequence |
Leu23-Leu450, with N-terminal GST Tag MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGSGGGSDDDDKLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL
|
| Expression System | HEK293 |
| Molecular Weight | 75-80kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | GST Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Colin G. Graydon, Shifa Mohideen and Keith R.Fowke, LAG3’s Enigmatic Mechanism of Action. Frontiers in Immunology |
Background
LAG3 is a member of the immunoglobulin superfamily and a CD4 ancestral homolog, resulting from a gene duplication event. Like CD4, LAG3 binds MHC class II (MHCII), but also FGL-1,α-synuclein fibrils (α-syn) and the lectins galectin-3 (Gal-3) and lymph node sinusoidal endothelial cell C-type lectin (LSECtin). As an immune checkpoint, LAG3 inhibits the activation of its host cell and generally promotes a more suppressive immune response. On T cells, LAG3 reduces cytokine and granzyme production and proliferation while encouraging differentiation into T regulatory cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy