FcRn His Tag Protein, Cynomolgus
SKU: 55159807640

FcRn His Tag Protein, Cynomolgus

Sale price$378.00 Regular price$420.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FcRn His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms FcRn, FCGRT & B2M Accession Q8SPV9(FcRn) Amino Acid Sequence FcRn: Ala24 Ser297, with C terminal 8*His AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSSGGGSHHHHHHHH B2M: Ile21

Product Specification


Species Cynomolgus
Synonyms FcRn, FCGRT & B2M
Accession Q8SPV9(FcRn)
Amino Acid Sequence

FcRn:Ala24-Ser297, with C-terminal 8*His AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSSGGGSHHHHHHHH B2M:Ile21-Met119 IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Expression System HEK293
Molecular Weight 32-35&11-13kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Roopenian D. et al. (2007) FcRn: the neonatal Fc receptor comes of age. Nat Rev Immunol. 7: 715-725.

Background

FcRn is an unusual Fc receptor, the biological importance of which is only beginning to be fully appreciated. In addition to its critical role in the transfer of maternal IgG to the fetus or neonate, FcRn is the homeostatic receptor responsible for extending the serum half-life of IgG in adults. The exact site(s) of IgG protection from degradation has not been delineated in vivo, but both endothelial cells and bone-marrow-derived cells can extend the serum persistence of IgG. FcRn is also expressed in many other tissues in the adult animal, including barrier sites such as the blood–brain interface, the glomerular filter in the kidneys and the intestinal epithelium. FcRn expression at these sites merits further study with the goals of modulating specific IgG transport to promote host defence or to control immune-complex deposition.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 55159807640

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 2116 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Charlottesville, US
★★★★★ 5
Works well.
Size: 100 Count (Pack of 1), Style: Melatonin 1mg
Works well!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
S
Verified Purchase
Sharis
San Leandro, US
★★★★★ 5
My favorite Melatonin supplement
Size: 100 Count (Pack of 1), Style: Melatonin 1mg
I have used this for a few months and really like it. I had previously used a spray that for some reason had added B6 (>2000% RDA) and I developed toxic levels of Vitamin B6 so had to switch. I love that this doesn't have any added garbage including no added flavors, artificial sweeteners or artificial dyes. The taste is fine. It's not candy and isn't supposed to taste like candy. It is just a bland taste that I hardly notice. Dissolves quickly and easily. Love it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 27, 2024
R
Verified Purchase
R. Taylor
Fort Morgan, US
★★★★★ 5
TLDR: Don't wait! Buy it now! This stuff is really great and I think you're gonna love it!
Size: 90 Count (Pack of 1)
Life Extension Neuro-mag: I first learned about magnesium l-threonate on YouTube. It was recommended by several physicians there and in person, all of whom consistently make good suggestions in terms of health optimization. Even still, I didn't go for it right away, unsure if this form of magnesium could really be much different than or better than the liquid magnesium from Life Extension that I've been using with great results for several years now. Still, I was curious, as I did some more research and I kept hearing and reading that magnesium l-threonate is “different” because it crosses the blood-brain barrier. Now I'm not gonna try to explain in detail what that is, but I had an understanding of it enough that hearing this further intrigued me. It's my understanding that the human body has this protective measure in place to protect us and for very good reasons so I wanted to be sure I'm making a safe decision for me. As an overview, basically you want the good stuff you consume, that your brain needs to function, to be able to make it to your brain- but not everything. I don't know how our bodies work this out, but apparently they do, so we don't have to figure it out on our own. Imagine that, trying to tell your gut where to send each calorie and nutrient etc.? Anyway, I decided to give this stuff a chance and within 3 days I knew that I will never go without this form of magnesium again if I can help it. For me, it's really that amazing, and of course as a consumer, I hesitate to say, but it's absolutely worth the asking price and more. I've had years of experience with this brand now too and it's been top notch from the packaging to the product, so I will keep buying from Life Extension. With this I sleep better, problem solving is less stressful and my energy level has improved. It does have the relaxing effect on my body that other forms of magnesium do too, but this one has such a profound effect on my mind it's very difficult to quantify, or put into words in text that can even begin to convey or actually help you comprehend just how powerful the effects are. Kind of like the old saying “you had to be there” I suppose. That said, eventually I did buy the magnesium l-threonate from Life Extension and it is quite literally one of the best decisions I've EVER made in my nearly 50 years. It's weird to say that, am I really that old? Seriously, if you do some research and find that the effects sound like the type you might benefit from- buy it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 24, 2024
L
Verified Purchase
Luke
Waukegan, US
★★★★★ 5
Great Product
Size: 90 Count (Pack of 1)
Life Extension’s Neuro-Mag Magnesium L-Threonate is a standout supplement designed to support cognitive health, and after trying it for several months, I can see why it’s so highly regarded. This product contains magnesium L-threonate, a unique form of magnesium that’s specifically formulated to cross the blood-brain barrier, making it highly effective for brain health. Each serving (three vegetarian capsules or one scoop of the tropical punch powder) delivers 2,000 mg of magnesium L-threonate, providing 144 mg of elemental magnesium. Here’s my take on its performance, benefits, and overall experience. Pros: • Cognitive Support: I noticed improved mental clarity and focus after about two weeks of consistent use. Tasks that require working memory, like recalling details or multitasking, felt smoother and less taxing. This aligns with research indicating magnesium L-threonate’s ability to enhance synaptic density and cognitive function, particularly in aging individuals. • Sleep Benefits: While not marketed primarily for sleep, I found that taking it about an hour before bed helped me fall asleep faster and wake up feeling refreshed. This echoes user experiences shared on platforms like X, where some reported better sleep quality and daytime alertness. • High Absorption: Unlike other magnesium forms like oxide or citrate, which are better for whole-body benefits, magnesium L-threonate is designed for brain absorption. Studies cited by Life Extension show it can boost magnesium levels in cerebrospinal fluid by 15% in animal models, which likely contributes to its cognitive effects. • Clean Formula: The capsules are gluten-free, non-GMO, and vegetarian, with no major allergens or unnecessary fillers. The powder version has a pleasant tropical punch flavor, making it easy to mix with water or juice. • Trusted Brand: Life Extension’s rigorous testing for purity and potency gives confidence in the product’s quality. Their transparency, including offering Certificates of Analysis, is reassuring. Cons: • Price Point: Neuro-Mag is pricier than standard magnesium supplements, which might be a drawback for budget-conscious buyers. However, the specialized form and targeted benefits justify the cost for those prioritizing brain health. • Time to Notice Effects: While some users report benefits in as little as six weeks, full effects may take up to 12 weeks, requiring patience. Final Verdict: Life Extension’s Neuro-Mag Magnesium L-Threonate is a high-quality supplement that delivers on its promise of supporting cognitive health. Its ability to enhance memory, focus, and even sleep quality makes it a worthwhile investment for those prioritizing brain function. Great benefits and clean formulation make it a top choice!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 16, 2025
H
Verified Purchase
Hannah Bannan
Battle Creek, US
★★★★★ 5
Effective results
Size: 90 Count (Pack of 1)
This is the only supplement I take where I actually feel its effects. It helps regulate my sleep, helps brain function and anxiety, just makes me feel better overall! And it’s not rough on the stomach at all. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026

recommand products