Pay in installments of $46.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 17 - Jul 22
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human pro-GRP, His TagProduct Specification Species Human Accession P07492 Amino Acid Sequence Protein sequence(P07492, Ser54 Asp121 with C 10*His) STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 9. 4kDa Actual: 13kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution Reconstitute no more than 0. 1 mg mL
Product Specification
| Species | Human |
| Accession | P07492 |
| Amino Acid Sequence |
Protein sequence(P07492, Ser54-Asp121 with C-10*His)
|
| Expression System | HEK293 |
| Molecular Weight | Theoretical: 9.4kDa Actual: 13kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Pro-Gastrin-Releasing-Peptide, also known as Pro-GRP, is a Gastrin-Releasing-Peptide (GRP) precursor, a neurotransmitter that belongs to the bombesine/neuromedin B family. GRP stimulates the secretion of gastrin in order to increase the acidity of the gastric acid. Pro-GRP is a peptide composed of 125 amino acids, expressed in the nervous system and digestive tract. In pathological situations, GRP has mitogenic activity in vitro in many tumors such as pancreatic, small cell lung (SCLC), prostate, kidney, breast and colorectal cancers. GRP could operate as an autocrine growth factor. In cancers, GRP induces cell growth and inhibits apoptosis by shutting down the endoplasmic reticulum stress pathway. As early as 1994, research on Pro-GRP as a biomarker for small cell lung cancer began. Because of the very short half-life of GRP (2 minutes), the Pro-GRP is used for measurements and analysis. Since then, Pro-GRP has been used as a tumor marker for patients with small cell lung cancer (SCLC) in limited and extended stages.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy