Pay in installments of $70.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 17 - Jul 22
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human PSA, His TagProduct Specification Species Human Accession P07288 Amino Acid Sequence APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 28. 5 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation
Product Specification
| Species | Human |
| Accession | P07288 |
| Amino Acid Sequence | APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPGGGGSHHHHHHHHHH. |
| Expression System | HEK293 |
| Molecular Weight | 28.5 kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 0.2M PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Background
PSA (prostate-specific antigen) is a single-chain protein containing 237 amino acids, belonging to the tissue-specific chymotrypsin-like serine protease family, which can break down the main mucin in semen and liquefy semen. PSA is tissue specific and only exists in the cytoplasm of human prostate acinar and ductal epithelial cells. PSA is not tumor-specific. Prostatitis, benign prostatic hyperplasia, and prostate cancer all lead to an increase in total PSA levels (free PSA plus combined PSA).The main function of PSA is to decompose the colloidal protein in semen, liquefy the colloidal semen and enhance sperm mobility. Small amounts of PSA can leak into the blood from the prostate. However, the increase of PSA in serum is seen in pathological states of the prostate, such as prostatitis, benign prostatic hyperplasia and prostate cancer. This product is the recombinant human PSA protein expressed from human 293 cells (HEK293).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 14 reviews
Sort
Product Reviews
★★★★★ 5
Good purchase
Style: 3 Pound, Pair
These are just the right weight for me to start gaining muscle back in my arms, after a large weight loss. They are of good quality, they are covered in a nice rubber like coating that is soft to the touch. They are small enough that i can take them with me when I travel. My dog has got hold of them a couple times and played with them, and they held up just fine without any damage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
★★★★★ 5
Solid, grippy, and they don’t roll away!
Style: 10 Pound, Pair
I bought these because I’m finally trying to build a consistent home workout routine and didn't want to drop a fortune on name-brand weights. I’ve been using this 10lb pair for about a month now for everything from overhead presses to lunges, and honestly, they’re exactly what I was looking for.
The Pros:
• That Neoprene Grip: The coating is fantastic. Even when my hands get pretty sweaty halfway through a workout, I don’t feel like I’m going to drop them. It’s a much "softer" feel than cold metal or hard plastic.
• The Hex Shape: This is a small detail that makes a huge difference. Since the ends are hexagonal, they don't roll across the floor when I set them down between sets. They also stay put if I’m using them for "renegade rows" or floor work.
• Compact Size: They aren’t bulky. I can easily shove them under my bed or in the corner of the closet when I’m done.
• No Weird Odor: I was worried they might smell like a tire factory (which happens with some rubber-coated weights), but these had almost no scent right out of the box.
The Cons:
• Handle Diameter: The handles are a little on the thicker side. I have medium-sized hands and it’s fine, but if you have very small hands, they might feel a bit chunky to wrap your fingers all the way around.
• Color Scuffs: The navy blue looks great, but if you clank them together or drop them on concrete, the coating can scuff or show dust pretty easily.
The Verdict:
If you just need a reliable set of weights for HIIT, Pilates, or general strength training, these are a no-brainer. You're basically getting gym-quality equipment for a fraction of the price. I’ll probably be back for the 15lb set in a few months!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 27, 2026
★★★★★ 5
Simple, Comfortable, and Exactly What You Expect
Style: Rack with 3 Pairs (5, 10, and 15 Pound)
These are pretty much exactly what you want from a set of dumbbells — simple, functional, and no nonsense. The neoprene coating gives them a comfortable grip and keeps them from feeling slick in your hands, especially during longer workouts or if your hands get sweaty.
The coating also helps keep them from banging up floors or making as much noise compared to bare metal weights, which is nice if you’re working out at home.
Weight accuracy seems fine for general fitness use, and they’ve worked great for things like accessory movements, shoulder work, lighter presses, rehab-style exercises, and general muscle toning. The shape also helps keep them from rolling around everywhere when set down.
They’re not fancy, and they’re not trying to be — they’re just dependable dumbbells that do what they’re supposed to do at a fair price.
If you want straightforward hand weights for home workouts without overthinking it, these are a solid buy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
★★★★★ 5
Reliable, Comfortable Dumbbells I Actually Use Every Day
Style: 12 Pound, Pair, Style: 12 Pound, Pair
I’ve been using the Amazon Basics Neoprene Dumbbell Hand Weights daily, and they’ve honestly been perfect for my routine. Whether I’m doing a quick morning workout or adding resistance to a longer session, these have held up really well.
The neoprene coating makes a big difference—it provides a comfortable, non-slip grip, even during longer workouts or when my hands get a little sweaty. They’re also easy to clean and don’t have that strong rubber smell some weights can have.
I really appreciate the hex shape too. They stay put when I set them down (no rolling across the floor), which makes switching between exercises quick and frustration-free. The weight feels evenly distributed and well-balanced, so movements feel controlled and smooth.
Overall, these are simple, no-frills dumbbells that just work. If you’re looking for reliable hand weights for everyday use—whether you’re a beginner or just need something dependable for home workouts—these are a great choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
★★★★★ 5
Great quality and perfect for home workouts!
Style: Rack with 3 Pairs (3, 5, and 8 Pound)
I’m really happy with this dumbbell set. The weights are clearly labeled (3 lb, 5 lb, and 8 lb), which makes it super convenient to switch between exercises. The neoprene coating feels comfortable in hand and provides a good grip, even during longer workouts.
The storage stand is a big plus—it keeps everything organized and saves space, which is perfect for a small home gym. The colors are also nice and make it easy to quickly grab the weight you need.
Overall, this is a great set for beginners or anyone looking to add light strength training to their routine. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
recommand products
Guess GU00129-4901B 49mm
58.80
ZC121-8905D27GT-GT/EC By Regency Lighting - Majestic Collection Golden Teak Finish 5 Lights Dining Room
368.30
ZC121-9103D10FG/EC By Regency Lighting - Lillie Collection French Gold Finish 3 Lights Pendant Lamp
267.83
ZC121-9104D10PW/EC By Regency Lighting Lillie Collection 4 Light Chandeliers Pewter Finish
302.32
ZC121-9104D10AB/EC By Regency Lighting - Lillie Collection Antique Bronze Finish 4 Lights Pendant Lamp
301.75