SKU: 65578841527

LL-37

Sale price$58.50 Regular price$65.00
Save 10%

Pay in installments of $16.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 17 - Jul 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LL-37LL 37: Pioneering Antimicrobial Peptide for Research Advance Your Immunology Studies with LL 37 LL 37, a cathelicidin derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies. LL 37 Specifications: Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Molecular Weight: 4493. 33 g mol

LL-37: Pioneering Antimicrobial Peptide for Research

Advance Your Immunology Studies with LL-37

LL-37, a cathelicidin-derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies.

LL-37 Specifications:

  • Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • Molecular Weight: 4493.33 g/mol
  • Purity: >95%
  • Available in 10mg vials

Research Applications:

  • Antimicrobial mechanism studies
  • Innate immunity investigations
  • Wound healing research
  • Anti-biofilm activity analysis

Why Source LL-37 From Us?

  • Rigorous quality control ensures consistent purity
  • Comprehensive documentation, including certificates of analysis
  • Competitive pricing for research budgets
  • Prompt, discreet shipping to research facilities worldwide

Expand Your Research Horizons

Incorporate LL-37 into your studies to explore its diverse biological activities. Whether you’re investigating antimicrobial resistance, wound healing processes, or immune modulation, LL-37 offers a versatile tool for cutting-edge research. To buy LL-37 10mg or inquire about bulk orders, please contact our dedicated research support team. We’re committed to supporting your groundbreaking work in immunology and microbiology. Important: LL-37 is intended for research use only. Not for diagnostic, therapeutic, or human use. Elevate your antimicrobial peptide research – purchase LL-37 through our trusted platform today.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65578841527

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nospeedin
Lexington, US
★★★★★ 5
Must have!
Color: Gold
Best Paper Towel Holder ever! Heavy enough that you can grab a paper towel with one hand without ‘holding’ the holder itself. The spray bottle is icing on the cake. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
R
Renn my opinion!
Whiting, US
★★★★★ 4
Convenient All-in-One Paper Towel Holder with Built-In Spray Bottle
Color: Stainless Steel
This paper towel holder works exactly as advertised and has been a useful addition to my countertop. The built-in spray bottle is especially convenient—it keeps cleaning solution right where you need it, so you can spray and wipe in one quick step without grabbing another bottle. The one-handed tearing feature works well, and the spring-loaded arm provides just the right amount of resistance to help prevent the roll from unraveling. The weighted base also keeps it stable while pulling sheets, which makes it feel sturdy during use. The stainless steel design looks nice and feels well made, and overall it seems durable enough for everyday kitchen use. The only downside is the price, which feels a bit steep compared to basic paper towel holders. However, the added spray function and convenience do add value if you clean frequently. Overall, it’s a practical and well-designed kitchen accessory that does make everyday cleanup easier.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
L
Verified Purchase
Letty Orellana
Massapequa, US
★★★★★ 5
Best paper roll stand
Color: Black
Love it the spray its perfect all in one
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
A
Verified Purchase
Amazon Customer
Port Orchard, US
★★★★★ 5
Love It
Color: Black
Had a sime human towel paper holder with spray and it leaked from the beginning. Found this one for less and it has been working great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
M
Verified Purchase
Michele S
Whiting, US
★★★★★ 5
Love this!
Color: Stainless Steel
I love this! The spray bottle is so convenient.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026

recommand products